Lineage for d3wwkk_ (3wwk K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2607280Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2607740Protein automated matches [190329] (10 species)
    not a true protein
  7. 2607803Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [188489] (10 PDB entries)
  8. 2607812Domain d3wwkk_: 3wwk K: [296139]
    Other proteins in same PDB: d3wwkc_, d3wwke_, d3wwkf_, d3wwki_, d3wwkl_
    automated match to d3bx4d_

Details for d3wwkk_

PDB Entry: 3wwk (more details), 2.98 Å

PDB Description: crystal structure of clec-2 in complex with rhodocytin
PDB Compounds: (K:) Snaclec rhodocytin subunit beta

SCOPe Domain Sequences for d3wwkk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wwkk_ d.169.1.1 (K:) automated matches {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]}
dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
fka

SCOPe Domain Coordinates for d3wwkk_:

Click to download the PDB-style file with coordinates for d3wwkk_.
(The format of our PDB-style files is described here.)

Timeline for d3wwkk_: