![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) ![]() different families share similar but non-identical metal-binding sites |
![]() | Family c.1.15.3: Xylose isomerase [51665] (2 proteins) |
![]() | Protein D-xylose isomerase [51666] (13 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [51675] (1 PDB entry) |
![]() | Domain d1a0dc_: 1a0d C: [29535] complexed with mn |
PDB Entry: 1a0d (more details), 3 Å
SCOPe Domain Sequences for d1a0dc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0dc_ c.1.15.3 (C:) D-xylose isomerase {Bacillus stearothermophilus [TaxId: 1422]} pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg rqerlktllnqyllevc
Timeline for d1a0dc_: