Lineage for d1a0dc_ (1a0d C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19614Superfamily c.1.15: Xylose isomerase-like [51658] (3 families) (S)
  5. 19635Family c.1.15.3: Xylose isomerase [51665] (1 protein)
  6. 19636Protein D-xylose isomerase [51666] (12 species)
  7. 19729Species Bacillus stearothermophilus [TaxId:1422] [51675] (1 PDB entry)
  8. 19732Domain d1a0dc_: 1a0d C: [29535]

Details for d1a0dc_

PDB Entry: 1a0d (more details), 3 Å

PDB Description: xylose isomerase from bacillus stearothermophilus

SCOP Domain Sequences for d1a0dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0dc_ c.1.15.3 (C:) D-xylose isomerase {Bacillus stearothermophilus}
pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
rqerlktllnqyllevc

SCOP Domain Coordinates for d1a0dc_:

Click to download the PDB-style file with coordinates for d1a0dc_.
(The format of our PDB-style files is described here.)

Timeline for d1a0dc_: