PDB entry 1a0d

View 1a0d on RCSB PDB site
Description: xylose isomerase from bacillus stearothermophilus
Class: ketolisomerase
Keywords: ketolisomerase, xylose metabolism, glucose-fructose interconversion, hydride transfer, alpha-beta barrel, metalloenzyme, thermophile
Deposited on 1997-11-28, released 1998-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.193
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0da_
  • Chain 'B':
    Compound: xylose isomerase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0db_
  • Chain 'C':
    Compound: xylose isomerase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0dc_
  • Chain 'D':
    Compound: xylose isomerase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1a0dd_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1a0dA (A:)
    pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
    gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
    dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
    nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
    dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
    lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
    avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
    rqerlktllnqyllevcaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0dA (A:)
    pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
    gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
    dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
    nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
    dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
    lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
    avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
    rqerlktllnqyllevc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1a0dB (B:)
    pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
    gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
    dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
    nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
    dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
    lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
    avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
    rqerlktllnqyllevcaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0dB (B:)
    pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
    gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
    dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
    nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
    dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
    lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
    avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
    rqerlktllnqyllevc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1a0dC (C:)
    pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
    gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
    dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
    nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
    dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
    lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
    avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
    rqerlktllnqyllevcaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0dC (C:)
    pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
    gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
    dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
    nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
    dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
    lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
    avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
    rqerlktllnqyllevc
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1a0dD (D:)
    pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
    gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
    dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
    nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
    dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
    lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
    avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
    rqerlktllnqyllevcaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1a0dD (D:)
    pyfdnistiayegpasknplafkfynpeekvgdktmeehlrfsvaywhtftgdgsdpfga
    gnmirpwnkysgmdlakarveaafeffeklnipffcfhdvdiapegetlketyknldiiv
    dmieeymktsktkllwntanlfthprfvhgaatscnadvfayaaakvkkgleiakrlgae
    nyvfwggregyetllntdmkleldnlarflhmavdyakeigfdgqfliepkpkeptkhqy
    dfdvatalaflqtyglkdyfkfnieanhatlaghtfehelrvarihgmlgsvdanqgdml
    lgwdtdefptdlysttlamyeilkngglgrgglnfdakvrrgsfepedlfyahiagmdsf
    avglkvahrliedrvfdefieeryksytegigreivegtadfhkleahalqlgeiqnqsg
    rqerlktllnqyllevc