SCOPe 2.08: Domain d3oehr_: 3oeh R:

Lineage for d3oehr_ (3oeh R:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family)
   automatically mapped to Pfam PF04627

5. Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)

6. Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310956] (5 PDB entries)

8. Domain d3oehr_: 3oeh R: [294219]
   Other proteins in same PDB: d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehg_, d3oehh1, d3oehh2, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehp_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3
   automated match to d2hldi_
   complexed with anp, mg; mutant

Details for d3oehr_

PDB Entry: 3oeh, 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F

PDB Compounds: (R:) ATP synthase subunit epsilon

SCOPe Domain Sequences for d3oehr_:

Sequence, based on SEQRES records:

>d3oehr_ a.137.8.1 (R:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yaaylnvaaqairsslktelqtasvlnrsqtdafytqy

Sequence, based on observed residues (ATOM records):

>d3oehr_ a.137.8.1 (R:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yaaylnvaaqairtelqtasvlnrsqtdafytqy

Timeline for d3oehr_:

• d3oehr_ first appeared in SCOPe 2.06
  
• d3oehr_ appears in SCOPe 2.07