| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) ![]() |
| Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
| Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310898] (6 PDB entries) |
| Domain d3oehd3: 3oeh D:358-475 [248219] Other proteins in same PDB: d3oehd1, d3oehd2, d3oehe1, d3oehe2, d3oehf1, d3oehf2, d3oehg_, d3oehh1, d3oehh2, d3oehi_, d3oehm1, d3oehm2, d3oehn1, d3oehn2, d3oeho1, d3oeho2, d3oehp_, d3oehr_, d3oehv1, d3oehv2, d3oehw1, d3oehw2, d3oehx1, d3oehx2 automated match to d2jdid1 complexed with anp, mg; mutant |
PDB Entry: 3oeh (more details), 3 Å
SCOPe Domain Sequences for d3oehd3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oehd3 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
Timeline for d3oehd3:
View in 3DDomains from other chains: (mouse over for more information) d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehg_, d3oehh1, d3oehh2, d3oehi_, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehp_, d3oehr_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3 |