Lineage for d3oehi_ (3oeh I:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2012335Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2012486Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family) (S)
    automatically mapped to Pfam PF04627
  5. 2012487Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 protein domains)
  6. 2012488Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species)
  7. 2012489Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310956] (5 PDB entries)
  8. 2012499Domain d3oehi_: 3oeh I: [294218]
    Other proteins in same PDB: d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehg_, d3oehh1, d3oehh2, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehp_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3
    automated match to d2hldi_
    complexed with anp, mg; mutant

Details for d3oehi_

PDB Entry: 3oeh (more details), 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
PDB Compounds: (I:) ATP synthase subunit epsilon

SCOPe Domain Sequences for d3oehi_:

Sequence, based on SEQRES records: (download)

>d3oehi_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpitk

Sequence, based on observed residues (ATOM records): (download)

>d3oehi_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isyaaylnvaaqairsktelqtasvlnrsqtdafytqyknaseptpitk

SCOPe Domain Coordinates for d3oehi_:

Click to download the PDB-style file with coordinates for d3oehi_.
(The format of our PDB-style files is described here.)

Timeline for d3oehi_:

  • d3oehi_ is new in SCOPe 2.06-stable