Lineage for d3oehh1 (3oeh H:11-90)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2073725Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 2073726Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 2073727Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 protein domains)
  6. 2073728Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
    delta subunit in mitochondria
  7. 2073729Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310954] (5 PDB entries)
  8. 2073736Domain d3oehh1: 3oeh H:11-90 [294216]
    Other proteins in same PDB: d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehg_, d3oehh2, d3oehi_, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehp_, d3oehr_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3
    automated match to d2hldh1
    complexed with anp, mg; mutant

Details for d3oehh1

PDB Entry: 3oeh (more details), 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
PDB Compounds: (H:) ATP synthase subunit delta

SCOPe Domain Sequences for d3oehh1:

Sequence, based on SEQRES records: (download)

>d3oehh1 b.93.1.1 (H:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffi
sggfatvqpdsqlcvtaiea

Sequence, based on observed residues (ATOM records): (download)

>d3oehh1 b.93.1.1 (H:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisg
gfatvqpdsqlcvtaiea

SCOPe Domain Coordinates for d3oehh1:

Click to download the PDB-style file with coordinates for d3oehh1.
(The format of our PDB-style files is described here.)

Timeline for d3oehh1:

  • d3oehh1 is new in SCOPe 2.06-stable