SCOPe 2.08: Domain d3oehh1: 3oeh H:11-90

Lineage for d3oehh1 (3oeh H:11-90)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
   pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns

4. Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family)

5. Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)

6. Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
   delta subunit in mitochondria

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310954] (5 PDB entries)

8. Domain d3oehh1: 3oeh H:11-90 [294216]
   Other proteins in same PDB: d3oehd1, d3oehd2, d3oehd3, d3oehe1, d3oehe2, d3oehe3, d3oehf1, d3oehf2, d3oehf3, d3oehg_, d3oehh2, d3oehi_, d3oehm1, d3oehm2, d3oehm3, d3oehn1, d3oehn2, d3oehn3, d3oeho1, d3oeho2, d3oeho3, d3oehp_, d3oehr_, d3oehv1, d3oehv2, d3oehv3, d3oehw1, d3oehw2, d3oehw3, d3oehx1, d3oehx2, d3oehx3
   automated match to d2hldh1
   complexed with anp, mg; mutant

Details for d3oehh1

PDB Entry: 3oeh, 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F

PDB Compounds: (H:) ATP synthase subunit delta

SCOPe Domain Sequences for d3oehh1:

Sequence, based on SEQRES records:

>d3oehh1 b.93.1.1 (H:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffi
sggfatvqpdsqlcvtaiea

Sequence, based on observed residues (ATOM records):

>d3oehh1 b.93.1.1 (H:11-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisg
gfatvqpdsqlcvtaiea

Timeline for d3oehh1:

• d3oehh1 first appeared in SCOPe 2.06
  
• d3oehh1 appears in SCOPe 2.07