Lineage for d1a3xb2 (1a3x B:1-87,B:189-366)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19439Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 19440Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 19441Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 19442Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51627] (2 PDB entries)
  8. 19446Domain d1a3xb2: 1a3x B:1-87,B:189-366 [29291]
    Other proteins in same PDB: d1a3xa1, d1a3xa3, d1a3xb1, d1a3xb3

Details for d1a3xb2

PDB Entry: 1a3x (more details), 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with pg, mn2+ and k+
PDB Compounds: (B:)

SCOP Domain Sequences for d1a3xb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3xb2 c.1.12.1 (B:1-87,B:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
msrlerltslnvvagsdlrrtsiigtigpktnnpetlvalrkaglnivrmnfshgsyeyh
ksvidnarkseelypgrplaialdtkgXpalsekdkedlrfgvkngvhmvfasfirtand
vltirevlgeqgkdvkiivkienqqgvnnfdeilkvtdgvmvargdlgieipapevlavq
kkliaksnlagkpvicatqmlesmtynprptraevsdvgnaildgadcvmlsgetakgny
pinavttmaetaviaeqaiaylpnyd

SCOP Domain Coordinates for d1a3xb2:

Click to download the PDB-style file with coordinates for d1a3xb2.
(The format of our PDB-style files is described here.)

Timeline for d1a3xb2: