SCOP 1.55: Domain d1a3xb1: 1a3x B:88-188

Lineage for d1a3xb1 (1a3x B:88-188)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.58: Pyruvate kinase beta-barrel domain [50799] (1 superfamily)

4. Superfamily b.58.1: Pyruvate kinase beta-barrel domain [50800] (1 family)

5. Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)

6. Protein Pyruvate kinase [50802] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50806] (2 PDB entries)

8. Domain d1a3xb1: 1a3x B:88-188 [27063]
   Other proteins in same PDB: d1a3xa2, d1a3xa3, d1a3xb2, d1a3xb3

Details for d1a3xb1

PDB Entry: 1a3x, 3 Å

PDB Description: pyruvate kinase from saccharomyces cerevisiae complexed with pg, mn2+ and k+

SCOP Domain Sequences for d1a3xb1:

Sequence; same for both SEQRES and ATOM records:

>d1a3xb1 b.58.1.1 (B:88-188) Pyruvate kinase {Baker's yeast (Saccharomyces cerevisiae)}
peirtgtttndvdypippnhemifttddkyakacddkimyvdyknitkvisagriiyvdd
gvlsfqvlevvddktlkvkalnagkicshkgvnlpgtdvdl

Timeline for d1a3xb1:

• d1a3xb1 appears in SCOP 1.57
  
• d1a3xb1 appears in the current release, SCOPe 2.08