Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.1: Pyruvate kinase [51622] (1 protein) |
Protein Pyruvate kinase, N-terminal domain [51623] (6 species) this domain is interrupted by an all-beta domain C-terminal domain is alpha/beta |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (7 PDB entries) |
Domain d1a49c2: 1a49 C:1212-1315,C:1418-1595 [29257] Other proteins in same PDB: d1a49a1, d1a49a3, d1a49b1, d1a49b3, d1a49c1, d1a49c3, d1a49d1, d1a49d3, d1a49e1, d1a49e3, d1a49f1, d1a49f3, d1a49g1, d1a49g3, d1a49h1, d1a49h3 complexed with atp, k, mg, oxl |
PDB Entry: 1a49 (more details), 2.1 Å
SCOPe Domain Sequences for d1a49c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a49c2 c.1.12.1 (C:1212-1315,C:1418-1595) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe
Timeline for d1a49c2: