Lineage for d1a49c2 (1a49 C:1212-1315,C:1418-1595)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2837914Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2837915Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2837968Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [51625] (7 PDB entries)
  8. 2837979Domain d1a49c2: 1a49 C:1212-1315,C:1418-1595 [29257]
    Other proteins in same PDB: d1a49a1, d1a49a3, d1a49b1, d1a49b3, d1a49c1, d1a49c3, d1a49d1, d1a49d3, d1a49e1, d1a49e3, d1a49f1, d1a49f3, d1a49g1, d1a49g3, d1a49h1, d1a49h3
    complexed with atp, k, mg, oxl

Details for d1a49c2

PDB Entry: 1a49 (more details), 2.1 Å

PDB Description: bis mg-atp-k-oxalate complex of pyruvate kinase
PDB Compounds: (C:) pyruvate kinase

SCOPe Domain Sequences for d1a49c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a49c2 c.1.12.1 (C:1212-1315,C:1418-1595) Pyruvate kinase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgXpavsekdiqdlkfgv
eqdvdmvfasfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimva
rgdlgieipaekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavl
dgadcimlsgetakgdypleavrmqhliareaeaamfhrklfe

SCOPe Domain Coordinates for d1a49c2:

Click to download the PDB-style file with coordinates for d1a49c2.
(The format of our PDB-style files is described here.)

Timeline for d1a49c2: