Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (7 PDB entries) |
Domain d1a49c3: 1a49 C:1596-1730 [33111] Other proteins in same PDB: d1a49a1, d1a49a2, d1a49b1, d1a49b2, d1a49c1, d1a49c2, d1a49d1, d1a49d2, d1a49e1, d1a49e2, d1a49f1, d1a49f2, d1a49g1, d1a49g2, d1a49h1, d1a49h2 complexed with atp, k, mg, oxl |
PDB Entry: 1a49 (more details), 2.1 Å
SCOPe Domain Sequences for d1a49c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a49c3 c.49.1.1 (C:1596-1730) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} elarssshstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr pgsgftntmrvvpvp
Timeline for d1a49c3: