Lineage for d1a49c1 (1a49 C:1316-1417)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804062Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2804063Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2804064Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2804065Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2804114Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (7 PDB entries)
  8. 2804125Domain d1a49c1: 1a49 C:1316-1417 [27028]
    Other proteins in same PDB: d1a49a2, d1a49a3, d1a49b2, d1a49b3, d1a49c2, d1a49c3, d1a49d2, d1a49d3, d1a49e2, d1a49e3, d1a49f2, d1a49f3, d1a49g2, d1a49g3, d1a49h2, d1a49h3
    complexed with atp, k, mg, oxl

Details for d1a49c1

PDB Entry: 1a49 (more details), 2.1 Å

PDB Description: bis mg-atp-k-oxalate complex of pyruvate kinase
PDB Compounds: (C:) pyruvate kinase

SCOPe Domain Sequences for d1a49c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a49c1 b.58.1.1 (C:1316-1417) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv
ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl

SCOPe Domain Coordinates for d1a49c1:

Click to download the PDB-style file with coordinates for d1a49c1.
(The format of our PDB-style files is described here.)

Timeline for d1a49c1: