![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
![]() | Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) ![]() |
![]() | Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein) this domain interrupts beta/alpha-barrel domain C-terminal domain is alpha/beta |
![]() | Protein Pyruvate kinase (PK) [50802] (6 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [50803] (7 PDB entries) |
![]() | Domain d1a49a1: 1a49 A:116-217 [27026] Other proteins in same PDB: d1a49a2, d1a49a3, d1a49b2, d1a49b3, d1a49c2, d1a49c3, d1a49d2, d1a49d3, d1a49e2, d1a49e3, d1a49f2, d1a49f3, d1a49g2, d1a49g3, d1a49h2, d1a49h3 complexed with atp, k, mg, oxl |
PDB Entry: 1a49 (more details), 2.1 Å
SCOPe Domain Sequences for d1a49a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a49a1 b.58.1.1 (A:116-217) Pyruvate kinase (PK) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} peirtglikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyv ddglislqvkqkgpdflvtevenggflgskkgvnlpgaavdl
Timeline for d1a49a1: