SCOPe 2.02: Domain d1fdzb_: 1fdz B:

Lineage for d1fdzb_ (1fdz B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein N-acetylneuraminate lyase [51571] (2 species)

7. Species Escherichia coli [TaxId:562] [51572] (4 PDB entries)

8. Domain d1fdzb_: 1fdz B: [29076]
   complexed with pyr

Details for d1fdzb_

PDB Entry: 1fdz, 2.6 Å

PDB Description: n-acetylneuraminate lyase in complex with pyruvate via borohydride reduction

PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d1fdzb_:

Sequence; same for both SEQRES and ATOM records:

>d1fdzb_ c.1.10.1 (B:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]}
nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvl
eivaeegkgkikliahvgcvttaesqqlaasakrygfdavsavtpfyypfsfeehcdhyr
aiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehpd
lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi
dlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmq

Timeline for d1fdzb_:

• d1fdzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fdzb_ appears in SCOPe 2.01
  
• d1fdzb_ appears in SCOPe 2.03
  
• d1fdzb_ appears in the current release, SCOPe 2.08