Lineage for d1fdzb_ (1fdz B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834890Protein N-acetylneuraminate lyase [51571] (2 species)
  7. 2834891Species Escherichia coli [TaxId:562] [51572] (4 PDB entries)
  8. 2834905Domain d1fdzb_: 1fdz B: [29076]
    complexed with pyr
    has additional insertions and/or extensions that are not grouped together

Details for d1fdzb_

PDB Entry: 1fdz (more details), 2.6 Å

PDB Description: n-acetylneuraminate lyase in complex with pyruvate via borohydride reduction
PDB Compounds: (B:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d1fdzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fdzb_ c.1.10.1 (B:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]}
nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvl
eivaeegkgkikliahvgcvttaesqqlaasakrygfdavsavtpfyypfsfeehcdhyr
aiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehpd
lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi
dlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmq

SCOPe Domain Coordinates for d1fdzb_:

Click to download the PDB-style file with coordinates for d1fdzb_.
(The format of our PDB-style files is described here.)

Timeline for d1fdzb_: