Lineage for d1fdzb_ (1fdz B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.10: Aldolase [51569] (4 families) 
Family c.1.10.1: Class I aldolase [51570] (6 proteins) Protein N-acetylneuraminate lyase [51571] (2 species) 
Species Escherichia coli [TaxId:562] [51572] (3 PDB entries) 
Domain d1fdzb_: 1fdz B: [29076]
Details for d1fdzb_
PDB Entry: 1fdz (more details), 2.6 Å
PDB Description: n-acetylneuraminate lyase in complex with pyruvate via borohydride reduction
SCOP Domain Sequences for d1fdzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fdzb_ c.1.10.1 (B:) N-acetylneuraminate lyase {Escherichia coli}
nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqvl
eivaeegkgkikliahvgcvttaesqqlaasakrygfdavsavtpfyypfsfeehcdhyr
aiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehpd
lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi
dlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmq
SCOP Domain Coordinates for d1fdzb_:
Click to download the PDB-style file with coordinates for d1fdzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fdzb_:
- d1fdzb_ appears in SCOP 1.57
- d1fdzb_ appears in the current release, SCOPe 2.08
View in 3D
