| Class b: All beta proteins [48724] (177 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
| Protein Lipoyl domain of the 2-oxoglutarate dehydrogenase complex [51243] (2 species) |
| Species Azotobacter vinelandii [TaxId:354] [51244] (2 PDB entries) |
| Domain d1ghka_: 1ghk A: [28231] |
PDB Entry: 1ghk (more details)
SCOPe Domain Sequences for d1ghka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghka_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]}
aidikaptfpesiadgtvatwhkkpgeavkrdelivdietdkvvmevlaeadgviaeivk
negdtvlsgellgkltegg
Timeline for d1ghka_: