Lineage for d1ghka_ (1ghk A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082732Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2082733Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)
  6. 2082768Protein Lipoyl domain of the 2-oxoglutarate dehydrogenase complex [51243] (2 species)
  7. 2082769Species Azotobacter vinelandii [TaxId:354] [51244] (2 PDB entries)
  8. 2082771Domain d1ghka_: 1ghk A: [28231]

Details for d1ghka_

PDB Entry: 1ghk (more details)

PDB Description: solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, 25 structures
PDB Compounds: (A:) e2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex

SCOPe Domain Sequences for d1ghka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghka_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]}
aidikaptfpesiadgtvatwhkkpgeavkrdelivdietdkvvmevlaeadgviaeivk
negdtvlsgellgkltegg

SCOPe Domain Coordinates for d1ghka_:

Click to download the PDB-style file with coordinates for d1ghka_.
(The format of our PDB-style files is described here.)

Timeline for d1ghka_: