Lineage for d1ghk__ (1ghk -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) 
Superfamily b.84.1: Single hybrid motif [51230] (1 family) 
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (5 proteins) 
Protein Lipoyl domain of the 2-oxoglutarate dehydrogenase complex [51243] (2 species) Species Azotobacter vinelandii [TaxId:354] [51244] (2 PDB entries) 
Domain d1ghk__: 1ghk - [28231]
Details for d1ghk__
PDB Entry: 1ghk (more details)
PDB Description: solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, 25 structures
SCOP Domain Sequences for d1ghk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghk__ b.84.1.1 (-) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii}
aidikaptfpesiadgtvatwhkkpgeavkrdelivdietdkvvmevlaeadgviaeivk
negdtvlsgellgkltegg
SCOP Domain Coordinates for d1ghk__:
Click to download the PDB-style file with coordinates for d1ghk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ghk__:
- d1ghk__ appears in SCOP 1.57
- d1ghk__ appears in the current release, SCOPe 2.08, called d1ghka_
View in 3D