SCOPe 2.08: Domain d1ghka_: 1ghk A:

Lineage for d1ghka_ (1ghk A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Lipoyl domain of the 2-oxoglutarate dehydrogenase complex [51243] (2 species)

7. Species Azotobacter vinelandii [TaxId:354] [51244] (2 PDB entries)

8. Domain d1ghka_: 1ghk A: [28231]

Details for d1ghka_

PDB Entry: 1ghk

PDB Description: solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, 25 structures

PDB Compounds: (A:) e2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex

SCOPe Domain Sequences for d1ghka_:

Sequence; same for both SEQRES and ATOM records:

>d1ghka_ b.84.1.1 (A:) Lipoyl domain of the 2-oxoglutarate dehydrogenase complex {Azotobacter vinelandii [TaxId: 354]}
aidikaptfpesiadgtvatwhkkpgeavkrdelivdietdkvvmevlaeadgviaeivk
negdtvlsgellgkltegg

Timeline for d1ghka_:

• d1ghka_ first appeared (with stable ids) in SCOP 1.55, called d1ghk__
  
• d1ghka_ appears in SCOPe 2.07