PDB entry 1ghk

View 1ghk on RCSB PDB site
Description: solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland II, nmr, 25 structures
Class: acyltransferase
Keywords: glycolysis, transferase, acyltransferase, lipoyl
Deposited on 1996-01-16, released 1997-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: e2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  Species: Azotobacter vinelandii [TaxId:354]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20708 (0-78)
  Domains in SCOPe 2.08: d1ghka_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ghkA (A:)
  aidikaptfpesiadgtvatwhkkpgeavkrdelivdietdkvvmevlaeadgviaeivk
  negdtvlsgellgkltegg