Lineage for d1caxd_ (1cax D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814551Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2814575Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 2814585Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (11 PDB entries)
  8. 2814611Domain d1caxd_: 1cax D: [28107]

Details for d1caxd_

PDB Entry: 1cax (more details), 2.6 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement
PDB Compounds: (D:) canavalin

SCOPe Domain Sequences for d1caxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1caxd_ b.82.1.2 (D:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
gqpr

SCOPe Domain Coordinates for d1caxd_:

Click to download the PDB-style file with coordinates for d1caxd_.
(The format of our PDB-style files is described here.)

Timeline for d1caxd_: