Lineage for d1caxa_ (1cax A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
  6. Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (11 PDB entries)
  8. Domain d1caxa_: 1cax A: [28104]

Details for d1caxa_

PDB Entry: 1cax (more details), 2.6 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement
PDB Compounds: (A:) canavalin

SCOPe Domain Sequences for d1caxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1caxa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
k

SCOPe Domain Coordinates for d1caxa_ are not available.

Timeline for d1caxa_:

Domains from other chains:
(mouse over for more information)
d1caxb_, d1caxc_, d1caxd_, d1caxe_, d1caxf_