SCOPe 2.08: Domain d2caua1: 2cau A:46-223

Lineage for d2caua1 (2cau A:46-223)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (11 PDB entries)

8. Domain d2caua1: 2cau A:46-223 [28092]

Details for d2caua1

PDB Entry: 2cau, 2.1 Å

PDB Description: canavalin from jack bean

PDB Compounds: (A:) protein (canavalin)

SCOPe Domain Sequences for d2caua1:

Sequence; same for both SEQRES and ATOM records:

>d2caua1 b.82.1.2 (A:46-223) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp

Timeline for d2caua1:

• d2caua1 first appeared (with stable ids) in SCOP 1.55
  
• d2caua1 appears in SCOPe 2.07