Lineage for d2caua1 (2cau A:46-223)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies) 
Superfamily b.82.1: RmlC-like [51182] (4 families) 
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (1 protein) Protein Seed storage 7S protein [51188] (2 species) Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries) 
Domain d2caua1: 2cau A:46-223 [28092]
Details for d2caua1
PDB Entry: 2cau (more details), 2.1 Å
PDB Description: canavalin from jack bean
SCOP Domain Sequences for d2caua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2caua1 b.82.1.2 (A:46-223) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
SCOP Domain Coordinates for d2caua1:
Click to download the PDB-style file with coordinates for d2caua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2caua1:
- d2caua1 appears in SCOP 1.57
- d2caua1 appears in the current release, SCOPe 2.08
View in 3D
