![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
![]() | Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species) synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase |
![]() | Species Salmonella typhimurium [TaxId:90371] [51185] (2 PDB entries) |
![]() | Domain d1dztb_: 1dzt B: [28079] complexed with aty, gol, so4, tpe |
PDB Entry: 1dzt (more details), 2.2 Å
SCOPe Domain Sequences for d1dztb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dztb_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal lte
Timeline for d1dztb_: