PDB entry 1dzt

View 1dzt on RCSB PDB site
Description: rmlc from salmonella typhimurium
Class: isomerase
Keywords: isomerase, 3,5 hexulose epimerase
Deposited on 2000-03-07, released 2000-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.232
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dzta_
  • Chain 'B':
    Compound: dtdp-4-dehydrorhamnose 3,5-epimerase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1dztb_
  • Heterogens: GOL, SO4, TPE, ATY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dztA (A:)
    mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr
    glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah
    gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal
    lte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dztB (B:)
    mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr
    glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah
    gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal
    lte