Lineage for d1dztb_ (1dzt B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17822Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 17823Family b.82.1.1: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51183] (1 protein)
  6. 17824Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (2 species)
  7. 17828Species Salmonella typhimurium [TaxId:90371] [51185] (2 PDB entries)
  8. 17832Domain d1dztb_: 1dzt B: [28079]

Details for d1dztb_

PDB Entry: 1dzt (more details), 2.2 Å

PDB Description: rmlc from salmonella typhimurium

SCOP Domain Sequences for d1dztb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dztb_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium}
mmiviktaipdvlilepkvfgdergfffesynqqtfeeligrkvtfvqdnhskskknvlr
glhfqrgenaqgklvrcavgevfdvavdirkesptfgqwvgvnlsaenkrqlwipegfah
gfvtlseyaeflykatnyyspssegsilwndeaigiewpfsqlpelsakdaaaplldqal
lte

SCOP Domain Coordinates for d1dztb_:

Click to download the PDB-style file with coordinates for d1dztb_.
(The format of our PDB-style files is described here.)

Timeline for d1dztb_: