SCOPe 2.08: Domain d4zmal2: 4zma L:49-86

Lineage for d4zmal2 (4zma L:49-86)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d4zmal2: 4zma L:49-86 [280577]
   Other proteins in same PDB: d4zmah_, d4zmal1, d4zmat1, d4zmat2
   automated match to d1danl1
   complexed with 0z6, bgc, ca, cac, fuc

Details for d4zmal2

PDB Entry: 4zma, 2.3 Å

PDB Description: crystal structure of a fviia-trypsin chimera (st) in complex with soluble tissue factor

PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d4zmal2:

Sequence; same for both SEQRES and ATOM records:

>d4zmal2 g.3.11.1 (L:49-86) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
qcasspcqnggsckdqlqsyicfclpafegrncethkd

Timeline for d4zmal2:

• d4zmal2 first appeared in SCOPe 2.05
  
• d4zmal2 appears in SCOPe 2.07