SCOPe 2.08: Domain d4zmat1: 4zma T:4-106

Lineage for d4zmat1 (4zma T:4-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d4zmat1: 4zma T:4-106 [280578]
   Other proteins in same PDB: d4zmah_, d4zmal1, d4zmal2, d4zmal3
   automated match to d1boya1
   complexed with 0z6, bgc, ca, cac, fuc

Details for d4zmat1

PDB Entry: 4zma, 2.3 Å

PDB Description: crystal structure of a fviia-trypsin chimera (st) in complex with soluble tissue factor

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d4zmat1:

Sequence, based on SEQRES records:

>d4zmat1 b.1.2.1 (T:4-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records):

>d4zmat1 b.1.2.1 (T:4-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypageplyenspeftpylet

Timeline for d4zmat1:

• d4zmat1 first appeared in SCOPe 2.05
  
• d4zmat1 appears in SCOPe 2.07