Lineage for d5d8jl2 (5d8j L:109-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364618Domain d5d8jl2: 5d8j L:109-214 [280323]
    Other proteins in same PDB: d5d8ja1, d5d8ja2, d5d8jl1
    automated match to d1h3pl2
    complexed with so4

Details for d5d8jl2

PDB Entry: 5d8j (more details), 3 Å

PDB Description: development of a therapeutic monoclonal antibody targeting secreted ap2 to treat type 2 diabetes.
PDB Compounds: (L:) HA3 Fab Light Chain

SCOPe Domain Sequences for d5d8jl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d8jl2 b.1.1.2 (L:109-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5d8jl2:

Click to download the PDB-style file with coordinates for d5d8jl2.
(The format of our PDB-style files is described here.)

Timeline for d5d8jl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d8jl1