SCOPe 2.08: Domain d5d8jl2: 5d8j L:109-214

Lineage for d5d8jl2 (5d8j L:109-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5d8jl2: 5d8j L:109-214 [280323]
   Other proteins in same PDB: d5d8ja1, d5d8ja2, d5d8jh1, d5d8jh2, d5d8jl1
   automated match to d1h3pl2
   complexed with so4

Details for d5d8jl2

PDB Entry: 5d8j, 3 Å

PDB Description: development of a therapeutic monoclonal antibody targeting secreted ap2 to treat type 2 diabetes.

PDB Compounds: (L:) HA3 Fab Light Chain

SCOPe Domain Sequences for d5d8jl2:

Sequence; same for both SEQRES and ATOM records:

>d5d8jl2 b.1.1.2 (L:109-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtdaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d5d8jl2:

• d5d8jl2 first appeared in SCOPe 2.05
  
• d5d8jl2 appears in SCOPe 2.07