SCOPe 2.08: Domain d5a87b_: 5a87 B:

Lineage for d5a87b_ (5a87 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [271524] (9 PDB entries)

8. Domain d5a87b_: 5a87 B: [279994]
   automated match to d2whga_
   complexed with gol, zn

Details for d5a87b_

PDB Entry: 5a87, 1.5 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim-5

PDB Compounds: (B:) metallo-beta-lactamase vim-5

SCOPe Domain Sequences for d5a87b_:

Sequence; same for both SEQRES and ATOM records:

>d5a87b_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
epsgeyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtaw
gakntaallaeiekqiglpvtravsthfhddrvggvdvlrkagvatyaspstrrlaeaeg
neipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlalsrts
agnvadadlaewptsveriqkhypeaevvipghglpggldllqhtanvvtahknr

Timeline for d5a87b_:

• d5a87b_ first appeared in SCOPe 2.05
  
• d5a87b_ appears in SCOPe 2.07