Lineage for d5a87a_ (5a87 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996879Species Klebsiella pneumoniae [TaxId:573] [271524] (9 PDB entries)
  8. 2996881Domain d5a87a_: 5a87 A: [279995]
    automated match to d2whga_
    complexed with gol, zn

Details for d5a87a_

PDB Entry: 5a87 (more details), 1.5 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim-5
PDB Compounds: (A:) metallo-beta-lactamase vim-5

SCOPe Domain Sequences for d5a87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a87a_ d.157.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlrkagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlalsrtsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvtahkn

SCOPe Domain Coordinates for d5a87a_:

Click to download the PDB-style file with coordinates for d5a87a_.
(The format of our PDB-style files is described here.)

Timeline for d5a87a_: