Lineage for d2whga_ (2whg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996833Protein automated matches [190079] (12 species)
    not a true protein
  7. 2996897Species Pseudomonas aeruginosa [TaxId:287] [189349] (76 PDB entries)
  8. 2996960Domain d2whga_: 2whg A: [169350]
    automated match to d1ko2a_
    complexed with flc, zn

Details for d2whga_

PDB Entry: 2whg (more details), 1.9 Å

PDB Description: crystal structure of the di-zinc metallo-beta-lactamase vim-4 from pseudomonas aeruginosa
PDB Compounds: (A:) vim-4 metallo-beta-lactamase

SCOPe Domain Sequences for d2whga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2whga_ d.157.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaeaegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavhelsrtsagnv
adadlaewptsveriqkhypeaevvipghglpggldllqhtanvvkahkn

SCOPe Domain Coordinates for d2whga_:

Click to download the PDB-style file with coordinates for d2whga_.
(The format of our PDB-style files is described here.)

Timeline for d2whga_: