Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) |
Protein automated matches [190079] (9 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [271524] (5 PDB entries) |
Domain d5a87b_: 5a87 B: [279994] automated match to d2whga_ complexed with gol, zn |
PDB Entry: 5a87 (more details), 1.5 Å
SCOPe Domain Sequences for d5a87b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a87b_ d.157.1.1 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} epsgeyptvneipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtaw gakntaallaeiekqiglpvtravsthfhddrvggvdvlrkagvatyaspstrrlaeaeg neipthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsanvlyggcavlalsrts agnvadadlaewptsveriqkhypeaevvipghglpggldllqhtanvvtahknr
Timeline for d5a87b_: