SCOPe 2.08: Domain d4uj3v_: 4uj3 V:

Lineage for d4uj3v_ (4uj3 V:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d4uj3v_: 4uj3 V: [276020]
   Other proteins in same PDB: d4uj3f_, d4uj3i_, d4uj3l_, d4uj3o_, d4uj3r_, d4uj3u_
   automated match to d2bmda1
   complexed with gnp, mg, pg4, so4

Details for d4uj3v_

PDB Entry: 4uj3, 3 Å

PDB Description: crystal structure of human rab11-rabin8-fip3

PDB Compounds: (V:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d4uj3v_:

Sequence, based on SEQRES records:

>d4uj3v_ c.37.1.0 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsq

Sequence, based on observed residues (ATOM records):

>d4uj3v_ c.37.1.0 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagleaitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlr
hlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsq

Timeline for d4uj3v_:

• d4uj3v_ first appeared in SCOPe 2.05
  
• d4uj3v_ appears in SCOPe 2.07