Lineage for d2bmda1 (2bmd A:6-186)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867445Protein Rab4a [142247] (1 species)
  7. 2867446Species Human (Homo sapiens) [TaxId:9606] [142248] (3 PDB entries)
    Uniprot P20338 2-172! Uniprot P20338 4-172! Uniprot P20338 4-184
  8. 2867450Domain d2bmda1: 2bmd A:6-186 [128789]
    complexed with gdp, gol

Details for d2bmda1

PDB Entry: 2bmd (more details), 1.8 Å

PDB Description: high resolution structure of gdp-bound human rab4a
PDB Compounds: (A:) ras-related protein rab4a

SCOPe Domain Sequences for d2bmda1:

Sequence, based on SEQRES records: (download)

>d2bmda1 c.37.1.8 (A:6-186) Rab4a {Human (Homo sapiens) [TaxId: 9606]}
tydflfkflvignagtgkscllhqfiekkfkddsnhtigvefgskiinvggkyvklqiwd
tagqerfrsvtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkk
dldadrevtfleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgeldperm
g

Sequence, based on observed residues (ATOM records): (download)

>d2bmda1 c.37.1.8 (A:6-186) Rab4a {Human (Homo sapiens) [TaxId: 9606]}
tydflfkflvignagtgkscllhqfiekkfkefgskiinvggkyvklqiwdtagqerfrs
vtrsyyrgaagallvyditsretynaltnwltdarmlasqniviilcgnkkdldadrevt
fleasrfaqenelmfletsaltgenveeafvqcarkilnkiesgeldpermg

SCOPe Domain Coordinates for d2bmda1:

Click to download the PDB-style file with coordinates for d2bmda1.
(The format of our PDB-style files is described here.)

Timeline for d2bmda1: