Lineage for d4uj3m_ (4uj3 M:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)
  8. 2114399Domain d4uj3m_: 4uj3 M: [276009]
    Other proteins in same PDB: d4uj3f_, d4uj3i_, d4uj3l_, d4uj3o_, d4uj3r_, d4uj3u_
    automated match to d2bmda1
    complexed with gnp, mg, pg4, so4

Details for d4uj3m_

PDB Entry: 4uj3 (more details), 3 Å

PDB Description: crystal structure of human rab11-rabin8-fip3
PDB Compounds: (M:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d4uj3m_:

Sequence, based on SEQRES records: (download)

>d4uj3m_ c.37.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqm

Sequence, based on observed residues (ATOM records): (download)

>d4uj3m_ c.37.1.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
dtagleraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqm

SCOPe Domain Coordinates for d4uj3m_:

Click to download the PDB-style file with coordinates for d4uj3m_.
(The format of our PDB-style files is described here.)

Timeline for d4uj3m_: