Lineage for d4uj3u_ (4uj3 U:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040629Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) (S)
  5. 3040630Family h.1.31.1: Eferin C-derminal domain-like [144271] (3 proteins)
    contains PfamB PB042332, PfamB PB026102
  6. 3040643Protein automated matches [275997] (1 species)
    not a true protein
  7. 3040644Species Human (Homo sapiens) [TaxId:9606] [275998] (1 PDB entry)
  8. 3040650Domain d4uj3u_: 4uj3 U: [276006]
    Other proteins in same PDB: d4uj3a_, d4uj3d_, d4uj3g_, d4uj3j_, d4uj3m_, d4uj3p_, d4uj3s_, d4uj3v_
    automated match to d2hv8e_
    complexed with gnp, mg, pg4, so4

Details for d4uj3u_

PDB Entry: 4uj3 (more details), 3 Å

PDB Description: crystal structure of human rab11-rabin8-fip3
PDB Compounds: (U:) Rab11 family-interacting protein 3

SCOPe Domain Sequences for d4uj3u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uj3u_ h.1.31.1 (U:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lmeaiqkqeeinfrlqdyidriivaimetnpsilevk

SCOPe Domain Coordinates for d4uj3u_:

Click to download the PDB-style file with coordinates for d4uj3u_.
(The format of our PDB-style files is described here.)

Timeline for d4uj3u_: