Lineage for d2rmcg_ (2rmc G:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) 
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (2 proteins) Protein Cyclophilin (eukaryotic) [50893] (7 species) 
Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry) 
Domain d2rmcg_: 2rmc G: [27494]
Details for d2rmcg_
PDB Entry: 2rmc (more details), 1.64 Å
PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a
SCOP Domain Sequences for d2rmcg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rmcg_ b.62.1.1 (G:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw
SCOP Domain Coordinates for d2rmcg_:
Click to download the PDB-style file with coordinates for d2rmcg_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rmcg_:
- d2rmcg_ appears in SCOP 1.57
- d2rmcg_ appears in the current release, SCOPe 2.08
View in 3D
