Lineage for d2rmcg_ (2rmc G:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 62537Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 62538Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 62539Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 62545Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 62623Species Mouse (Mus musculus), variant C [TaxId:10090] [50897] (1 PDB entry)
  8. 62627Domain d2rmcg_: 2rmc G: [27494]

Details for d2rmcg_

PDB Entry: 2rmc (more details), 1.64 Å

PDB Description: crystal structure of murine cyclophilin c complexed with immunosuppressive drug cyclosporin a

SCOP Domain Sequences for d2rmcg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rmcg_ b.62.1.1 (G:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C}
krgpsvtdkvffdvrigdkdvgriviglfgnvvpktvenfvalatgekgygykgsifhrv
ikdfmiqggdftardgtggmsiygetfpdenfklkhygigwvsmanagpdtngsqffitl
tkptwldgkhvvfgkvldgmtvvhsielqatdghdrpltdctivnsgkidvktpfvvevp
dw

SCOP Domain Coordinates for d2rmcg_:

Click to download the PDB-style file with coordinates for d2rmcg_.
(The format of our PDB-style files is described here.)

Timeline for d2rmcg_: