Lineage for d5akra2 (5akr A:167-340)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2772015Protein automated matches [226877] (4 species)
    not a true protein
  7. 2772016Species Achromobacter cycloclastes [TaxId:223] [274677] (3 PDB entries)
  8. 2772017Domain d5akra2: 5akr A:167-340 [274678]
    Other proteins in same PDB: d5akra1
    automated match to d2bw4a2
    complexed with act, cu, mli, no2, so4

Details for d5akra2

PDB Entry: 5akr (more details), 0.87 Å

PDB Description: atomic resolution structure of nitrite bound state of the achromobacter cycloclastes cu nitrite reductase at 0.87 a resolution
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d5akra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5akra2 b.6.1.3 (A:167-340) automated matches {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d5akra2:

Click to download the PDB-style file with coordinates for d5akra2.
(The format of our PDB-style files is described here.)

Timeline for d5akra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5akra1