![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (31 species) not a true protein |
![]() | Species Achromobacter cycloclastes [TaxId:223] [225121] (13 PDB entries) |
![]() | Domain d5akra1: 5akr A:4-166 [274676] Other proteins in same PDB: d5akra2 automated match to d1kcba1 complexed with act, cu, mli, no2, so4 |
PDB Entry: 5akr (more details), 0.87 Å
SCOPe Domain Sequences for d5akra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5akra1 b.6.1.0 (A:4-166) automated matches {Achromobacter cycloclastes [TaxId: 223]} aapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamt fngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlr fkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdek
Timeline for d5akra1: