Lineage for d2bw4a2 (2bw4 A:167-340)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)
  7. Species Achromobacter cycloclastes [TaxId:223] [419325] (60 PDB entries)
  8. Domain d2bw4a2: 2bw4 A:167-340 [129321]
    Other proteins in same PDB: d2bw4a1
    automated match to d1nifa2
    complexed with act, cu, mli, so4

    has additional insertions and/or extensions that are not grouped together

Details for d2bw4a2

PDB Entry: 2bw4 (more details), 0.9 Å

PDB Description: atomic resolution structure of resting state of the achromobacter cycloclastes cu nitrite reductase
PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2bw4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw4a2 b.6.1.3 (A:167-340) Nitrite reductase, NIR, C-terminal domain {Achromobacter cycloclastes [TaxId: 223]}
gqpltydkiyyvgeqdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavga
ltgdhaltaavgervlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipgg
tagaafytfrqpgvyayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm

SCOPe Domain Coordinates for d2bw4a2 are not available.

Timeline for d2bw4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bw4a1