PDB entry 5akr

View 5akr on RCSB PDB site
Description: atomic resolution structure of nitrite bound state of the achromobacter cycloclastes cu nitrite reductase at 0.87 a resolution
Class: oxidoreductase
Keywords: oxidoreductase, catalysis, nitrite reductases, oxidation-reduction, substrate specificity
Deposited on 2015-03-05, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 0.87 Å
R-factor: N/A
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Achromobacter cycloclastes [TaxId:223]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5akra1, d5akra2
  • Heterogens: CU, ACT, NO2, MLI, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5akrA (A:)
    mteqlqmtrrtmlagaalagavapllhtaqahaagaaaaagaapvdistlprvkvdlvkp
    pfvhahdqvaktgprvveftmtieekklvidregteihamtfngsvpgplmvvhendyve
    lrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkatkpgvfvyhcapegmv
    pwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpkdeagnykkyetpgea
    yedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsqanrdtrphligghgd
    yvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhnlieafelgaaghfkv
    tgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5akrA (A:)
    aapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamt
    fngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlr
    fkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdf
    yvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlv
    vhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyay
    vnhnlieafelgaaghfkvtgewnddlmtsvvkpasm