Lineage for d5bxqc_ (5bxq C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867618Protein Ran [52609] (2 species)
  7. 2867619Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries)
    Uniprot P62825
  8. 2867633Domain d5bxqc_: 5bxq C: [274453]
    Other proteins in same PDB: d5bxqa_, d5bxqb_
    automated match to d1a2kd_
    complexed with gdp, mg, so4
    has additional insertions and/or extensions that are not grouped together

Details for d5bxqc_

PDB Entry: 5bxq (more details), 2.5 Å

PDB Description: structure of the ntf2:rangdp complex
PDB Compounds: (C:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d5bxqc_:

Sequence, based on SEQRES records: (download)

>d5bxqc_ c.37.1.8 (C:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdleva

Sequence, based on observed residues (ATOM records): (download)

>d5bxqc_ c.37.1.8 (C:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivnlqyydisaksnynfekpflwlarkligdpnlefvampalappevvmdpa
laaqyehdleva

SCOPe Domain Coordinates for d5bxqc_:

Click to download the PDB-style file with coordinates for d5bxqc_.
(The format of our PDB-style files is described here.)

Timeline for d5bxqc_: