Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ran [52609] (2 species) |
Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries) Uniprot P62825 |
Domain d5bxqe_: 5bxq E: [274454] Other proteins in same PDB: d5bxqa_, d5bxqb_ automated match to d1a2ke_ complexed with gdp, mg, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 5bxq (more details), 2.5 Å
SCOPe Domain Sequences for d5bxqe_:
Sequence, based on SEQRES records: (download)
>d5bxqe_ c.37.1.8 (E:) Ran {Dog (Canis familiaris) [TaxId: 9615]} qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev vmdpalaaqyehdlevaqttalpde
>d5bxqe_ c.37.1.8 (E:) Ran {Dog (Canis familiaris) [TaxId: 9615]} qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrnlqyydisaksnynfekpflwlarkligdpnlefvampalappevvm dpalaaqyehdlevaqttalpde
Timeline for d5bxqe_:
View in 3D Domains from other chains: (mouse over for more information) d5bxqa_, d5bxqb_, d5bxqc_, d5bxqd_ |