Lineage for d1smpi_ (1smp I:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16669Fold b.61: Streptavidin-like [50875] (3 superfamilies)
  4. 16863Superfamily b.61.2: Metalloprotease inhibitor [50882] (1 family) (S)
  5. 16864Family b.61.2.1: Metalloprotease inhibitor [50883] (1 protein)
  6. 16865Protein Metalloprotease inhibitor [50884] (1 species)
  7. 16866Species Erwinia chrysanthemi [TaxId:556] [50885] (1 PDB entry)
  8. 16867Domain d1smpi_: 1smp I: [27417]
    Other proteins in same PDB: d1smpa1, d1smpa2

Details for d1smpi_

PDB Entry: 1smp (more details), 2.3 Å

PDB Description: crystal structure of a complex between serratia marcescens metallo-protease and an inhibitor from erwinia chrysanthemi

SCOP Domain Sequences for d1smpi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smpi_ b.61.2.1 (I:) Metalloprotease inhibitor {Erwinia chrysanthemi}
sslrlpsaaelsgqwvlsgaeqhcdirlntdvldgttwklagdtaclqkllpeapvgwrp
tpdgltltqadgsavaffsrnrdryehklvdgsvrtlkkk

SCOP Domain Coordinates for d1smpi_:

Click to download the PDB-style file with coordinates for d1smpi_.
(The format of our PDB-style files is described here.)

Timeline for d1smpi_: