Lineage for d1smpa2 (1smp A:4-246)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34307Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 34308Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (11 families) (S)
  5. 34370Family d.92.1.6: Metallo protease, catalytic (N-terminal) domain [55508] (1 protein)
  6. 34371Protein Metallo protease, catalytic (N-terminal) domain [55509] (2 species)
  7. 34375Species Serratia marcescens [TaxId:615] [55511] (4 PDB entries)
  8. 34379Domain d1smpa2: 1smp A:4-246 [40303]
    Other proteins in same PDB: d1smpa1, d1smpi_

Details for d1smpa2

PDB Entry: 1smp (more details), 2.3 Å

PDB Description: crystal structure of a complex between serratia marcescens metallo-protease and an inhibitor from erwinia chrysanthemi

SCOP Domain Sequences for d1smpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smpa2 d.92.1.6 (A:4-246) Metallo protease, catalytic (N-terminal) domain {Serratia marcescens}
tgydavddllhyhergngiqingkdsfsneqaglfitrenqtwngykvfgqpvkltfsfp
dykfsstnvagdtglskfsaeqqqqaklslqswadvanitftevaagqkanitfgnysqd
rpghydygtqayaflpntiwqgqdlggqtwynvnqsnvkhpatedygrqtftheighalg
lshpgdynagegnptyndvtyaedtrqfslmsywsetntggdngghyaaapllddiaaiq
hly

SCOP Domain Coordinates for d1smpa2:

Click to download the PDB-style file with coordinates for d1smpa2.
(The format of our PDB-style files is described here.)

Timeline for d1smpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1smpa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1smpi_